Please Please Me
“Last night I said these words to my girl”
Lennon's first UK No.1, originally conceived as a slow Roy Orbison-style ballad before George Martin sped it up. The 1963 hit broke the Beatles nationally and launched Beatlemania, with a famously confident 'You've just made your first No.1 record' from Martin in the control room.
advertisement
Did you know?more like this →
The Childhood motif first appears in the Beatles catalogue on 'Please Please Me' (1963).
Track7 · Side closer · Side 1
Songwriter(s)LennonCredited as Lennon–McCartney
RecordedNovember 26, 1962
ReleasedJanuary 11, 1963 (Single)March 22, 1963 (Please Please Me)
● hover for more info● long-press tags for more info
Text232 tags
Word cloud
Cover-shared words
allalwaysbluecomegirlhardheartknowlastlikelovemakememyneednevernightpleasesaidsaysoundtrywantwaywoahwordsyeahyouall thebut youcome ondon't wantgirl ihave toi doi don'ti knowi neveri saidin myknow youlast nightlike imake meme tomy girlmy heartplease pleasethe wayto mywant towith youwoah yeahyou don'tyou knowyou makeyou neverdon't want toi don't wantlast night iyou make me
Lyric shape
[ADJ] with[VERB] there's[VERB] these[WORD] even[WORD] haveeven [VERB]there's [WORD][ADJ] with you[WORD] [VERB] inbut you [VERB]do [WORD] thedo you [VERB]have to [VERB]i [WORD] havei do [WORD]it's so [ADV]me to [VERB]my [NOUN] inso [ADV] toto [NOUN] withto [VERB] [VERB]to [VERB] theto my [NOUN][NOUN] in my [NOUN][VERB] [NOUN] i [VERB][VERB] me to [VERB][VERB] the [NOUN] [VERB][VERB] to [VERB] [VERB]i don't [VERB] toto [VERB] the [NOUN]why do you [VERB]you [VERB] me [ADJ]you don't [VERB] me[NOUN] i [VERB] you [WORD]i don't [VERB] to [VERB][VERB] on [VERB] on [VERB] onon [VERB] on [VERB] on [VERB]
Cover-shared shape
[ADV] to[NOUN] i[NOUN] in[NOUN] to[NOUN] with[VERB] i[VERB] in[VERB] me[VERB] on[VERB] the[VERB] to[VERB] you[WORD] thedo [WORD]don't [VERB]i [VERB]i [WORD]me [ADJ]me [WORD]my [NOUN]on [VERB]so [ADV]the [ADJ]the [NOUN]these [NOUN]to [NOUN]to [VERB]you [VERB]you [WORD][NOUN] i [VERB][NOUN] in my[NOUN] with you[VERB] [NOUN] i[VERB] [VERB] me[VERB] i [VERB][VERB] me [ADJ][VERB] me [WORD][VERB] me to[VERB] on [VERB][VERB] the [NOUN][VERB] to [VERB][VERB] you [WORD][WORD] [VERB] i[WORD] the [ADJ]don't [VERB] medon't [VERB] toi [VERB] youi don't [VERB]in my [NOUN]me [WORD] [WORD]the [NOUN] [VERB]you [VERB] meyou don't [VERB][NOUN] i [VERB] you[VERB] i [VERB] you[VERB] me [WORD] [WORD][WORD] [VERB] i [VERB]don't [VERB] to [VERB]i [VERB] you [WORD]
Distinctive word
complainingpleasing
Music215 tags
Chord degree
♭VII–IV–II–IVIV–VV–IIV–vivi–iiI–VI–IV–VIV–V–IV–I–IVIV–vi–iiV–I–IV–IV–vivi–IVI–♭VII♭VII–IVIV–II–♭VII–IVIII–viV–vi–IVvi–IV–Vvi–IV–V–II–ii–iii–IVIV–I–iiii–iiiI–iiiii–IViii–VIV–V–I–IV–Iiii–IV–I♭VI–Ivi–IIIV–I–IV–I–IVI–ii–iiiV–vi–IIII–IV–viIII–vi–IVI–IV–I–IV–viii–iii–IV–Iii–iii–VIII–vi–IV–V–IV–vi–III–viI–IV–vi–ii♭VI–I–V–IIV–V–vi
Chord shape
C → B♭ → FC → G → DC → FC → DC → EmAm → DmC → EC → F → GC → D → GC → F → B♭C → Em → AmC → F → B♭ → FC → F → Am → DmC → DmAm → FC → B♭C → GAm → EC → FmC7 → FmC → Dm → B♭Am → F → GC → Dm → AC → Fm → D♭C7 → Fm → D♭Am → F → G → CAm → CC → G → AmC → Dm → Em → FAm → E7Am → B♭C → D → EmC → F → AmAm → B♭ → FC → Dm → EmAm → C7C → G → C → EmC → G → Am → BmC → F → C → F → AmAm → B♭ → F → GmAm → Bm → C → GAm → Bm → D7C7 → EC → Fm → D♭ → E♭ → A♭C → G → C → Em → AmC → Dm → A7 → DmAm → E → Am → FC → E → B → EAm → E♭C → F → B♭ → F → B♭C → D → G → C → GAm → Bm
Chord literal
E → AA → BB → EC♯m → F♯mA → C♯m → F♯mE → DD → AA → EC♯m → AE → F♯mE → BD → A → EB → E → AA → C♯mB → C♯mC♯m → A → BE → A → BC♯m → A → B → EG♯m → AB → E → A → EA → E → F♯mA → B → C♯mG♯ → C♯mE → A → C♯mB → C♯m → AE → A → E → A → C♯mE → A → C♯m → F♯mE → F♯m → G♯m → AC → E → B → EG♯7 → C♯m → AG♯ → C♯m → AG♯m → A → EC♯m → G♯7C♯m → G♯G♯m → BE → D → AC → EA → B → EG♯7 → C♯m
People10 tags
Info25 tags
You might also like:Questlove – Teaches Music Curation and DJingGuitareo – Guitar Lessons for Beginners
affiliate link – supports this wiki
Sources & references
Tags on this page are original analysis, transcribed and cross-checked against the fine work of others: Alan W. Pollack's “Notes on…” series, the Beatles Complete Scores (Hal Leonard), Mark Lewisohn's session histories, Ian MacDonald's Revolution in the Head, Dave Rybaczewski's Beatles Music History and Andy Babiuk's Beatles Gear for the instruments and studio equipment, and others besides – then verified by ear against the recordings. Full bibliography: Sources & thanks.
External entity links: Wikipedia · MusicBrainz recording · MusicBrainz work · Wikidata
Updated
advertisement
Feedback
Got a tag idea for Please Please Me? Or think we've got it all wrong – no, no, no? Don't let it be.